PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.13G073400.1.p
Common NameGLYMA_13G073400, LOC100800658
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 535aa    MW: 59014.6 Da    PI: 5.2155
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.13G073400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.46.7e-185097148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                         +g+WT+ Ed +lv++vk++G g+W+++ ++ g+ R++k+c++rw ++l
  Glyma.13G073400.1.p 50 KGPWTAAEDAILVEYVKKHGQGNWNAVQKHSGLARCGKSCRLRWANHL 97
                         79******************************************9986 PP

2Myb_DNA-binding50.93.6e-16103146146
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                          +g++T+eE+ +++++++++G++ W++ a++++ gRt++++k++w++
  Glyma.13G073400.1.p 103 KGAFTAEEENRILELHAKMGNK-WARMAAELP-GRTDNEIKNYWNT 146
                          799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.0824597IPR017930Myb domain
SuperFamilySSF466893.18E-3048144IPR009057Homeodomain-like
SMARTSM007175.1E-154999IPR001005SANT/Myb domain
PfamPF002494.3E-165097IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-2451104IPR009057Homeodomain-like
CDDcd001673.04E-125297No hitNo description
PROSITE profilePS5129424.70998152IPR017930Myb domain
SMARTSM007176.4E-16102150IPR001005SANT/Myb domain
PfamPF002495.2E-15103146IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-25105150IPR009057Homeodomain-like
CDDcd001671.29E-11105146No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 535 aa     Download sequence    Send to blast
MNLQSCILTA MSSMTSGGDT RKISKGRWSS SLDEKVGVGG NVGGEGPLKK GPWTAAEDAI  60
LVEYVKKHGQ GNWNAVQKHS GLARCGKSCR LRWANHLRPD LKKGAFTAEE ENRILELHAK  120
MGNKWARMAA ELPGRTDNEI KNYWNTRIKR MQRAGLPIYP EELCQRILNG NQESQNVGTM  180
TNEACHHDDL SQTNNFDIPD VEFKNFKFRH GLPHVPSIFD MPESSLFDQS SDSSHSYNFL  240
FPTMRPTKRP RESEMLYDSF GSCSINAAPL FDQYGNYTFE KISDHPGLSL PCDPVLNTTD  300
QFHGDNLTGS HAALNGNASA SVPIFGAMKL ELPSLQYPET QHGSWGPPMS PLPSLESVDT  360
LIQSPTLEPI LSDPISPQSS GLLEAIVYNS KSLKGSNNDL LLQETIATAN EVANISTLNH  420
SFQTEWDELG DPNSPLGQSA ASVLTDYTPV RMCSVDGYQS TETSQDHDDK HEAPTTQFPD  480
SSSKKKILKQ VDYTQPDALL DLGWFGNNTK YESDQFVQQD ALGALFGDNC QHQP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-31481505106B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.302660.0leaf| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003543825.20.0PREDICTED: transcription factor GAMYB-like isoform X1
TrEMBLA0A0R0GJT20.0A0A0R0GJT2_SOYBN; Uncharacterized protein
STRINGGLYMA13G04031.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20473485
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.37e-93myb domain protein 33